Skip to content

Cagrilintide

Status In clinical development, not approvedBest evidence E2Sources checked 2026-09-17

Cagrilintide is an investigational once-weekly amylin analogue, not approved anywhere, and it is not CagriSema. In the same phase 3 trial, REDEFINE 1, cagrilintide alone gave 11.8 percent weight loss at 68 weeks while the cagrilintide plus semaglutide combination gave 22.7 percent, so pages attributing the combination figure to cagrilintide are off by about a…

Identity

Sequence
{eicosanedioic acid-gamma-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2, with the native Cys2 to Cys7 disulfide retained and the C-terminus amidated. Six substitutions against human amylin (N14E, V17R, A25P, S28P, S29P, Y37P) plus the C20 diacid acylation on Lys1
Formula
C194H312N54O59S2, supplier data sheet only, not confirmed against a peer-reviewed or regulatory source
Molar mass
4409.01 g/mol average, supplier derived, not independently confirmed
CAS
1415456-99-3, supplier derived and cross-listed on secondary references, not confirmed against a primary source
PubChem CID
167312356

What it is

Cagrilintide is a synthetic analogue of human amylin, the hormone pancreatic beta cells release alongside insulin. It is a 37 amino acid peptide with six substitutions against the native sequence and a C20 dicarboxylic acid on the first residue, joined by a gamma-glutamate linker, injected subcutaneously once weekly. Novo Nordisk developed it as AM833 and NNC0174-0833. It is not approved anywhere.

Cagrilintide alone is not CagriSema, and this entry hangs on the distinction. CagriSema is a fixed-dose combination of cagrilintide and semaglutide in one dual-chamber pen. In REDEFINE 1, the same trial over the same 68 weeks at the same 2.4 mg dose, cagrilintide monotherapy gave 11.8 percent weight loss against 2.3 percent on placebo while the combination gave 22.7 percent (Garvey 2025 in the New England Journal of Medicine, with the four-arm breakdown from the sponsor announcement of 20 December 2024). Pages that hand the combination figure to cagrilintide are off by roughly a factor of two.

How it works

Amylin has no receptor gene of its own. The amylin receptors are heterodimers of the calcitonin receptor, a class B G-protein-coupled receptor encoded by CALCR, paired with one of three receptor activity-modifying proteins to give AMY1, AMY2 and AMY3, which swings preference from calcitonin towards amylin. Cagrilintide is deliberately non-selective across both. Fletcher and colleagues, profiling it in 2021 across 25 endpoints, recorded the observation behind that choice: amylin agonists that also hit the calcitonin receptor appear more efficacious in obesity, even though, in their words, selective activation of calcitonin receptors is not efficacious. Cryo-electron microscopy in 2025 traced the dual activation to the Glu14 to Arg17 salt bridge and the Pro37 contact with the receptor extracellular domain.

The site of action is the hindbrain, not primarily the hypothalamus: the area postrema and the adjacent nucleus of the solitary tract, outside the blood-brain barrier. A 2026 cross-species atlas in Nature Metabolism found that the acute response, in area postrema Calcr and Ramp3 neurons, does not sustain weight loss, while long-term treatment raises prolactin-releasing hormone expression in nucleus of the solitary tract Calcr and Prlh cells. Knocking down dorsal vagal complex Prlh abrogated the effects of cagrilintide but not semaglutide. That is a rat experiment, and it is the cleanest evidence that the two mechanisms are genuinely separate.

Native amylin could not be made into a drug at all. It aggregates into amyloid fibrils, the process that deposits islet amyloid in type 2 diabetes, and it clears in minutes, the obstacle Kruse and colleagues open their 2021 design paper on. Three of cagrilintide’s substitutions are anti-aggregation prolines borrowed from rat amylin, the same three that define pramlintide. The C20 diacid gives reversible albumin binding and a half-life of 159 to 195 hours, 6.6 to 8.1 days (Enebo 2021).

What the human trials found

The dose-finding trial is Lau 2021 in the Lancet, NCT03856047: 906 adults with overweight or obesity, no diabetes, 26 weeks including up to six weeks of escalation, randomised to cagrilintide 0.3, 0.6, 1.2, 2.4 or 4.5 mg weekly, liraglutide 3.0 mg daily or placebo. On the trial product estimand weight fell 6.0 to 10.8 percent across the cagrilintide doses against 3.0 percent on placebo, and 4.5 mg beat liraglutide at 10.8 against 9.0 percent. The per-arm estimates for 0.3, 0.6, 1.2 and 2.4 mg are not in the public abstract, so only the range and those anchors appear here.

The 15.4 to 17.1 percent figures often quoted come from the phase 1b trial, Enebo 2021, where all 95 exposed participants received semaglutide 2.4 mg, placebo groups included; they are exploratory combination results. In the phase 2 diabetes trial, Frias 2023, 92 patients, cagrilintide alone lowered HbA1c 0.9 percentage points against 1.8 for semaglutide, and the combination was not superior to semaglutide at p equals 0.075.

REDEFINE 1 randomised 3417 adults for 68 weeks and met both coprimary endpoints: minus 20.4 against minus 3.0 percent on the treatment policy estimand, difference minus 17.3 percentage points, 95 percent confidence interval minus 18.1 to minus 16.6, P less than 0.001. Its four arms on the trial product estimand were 22.7 percent combination, 16.1 semaglutide, 11.8 cagrilintide and 2.3 placebo, and 31.6 percent of the monotherapy group reached 15 percent or more weight loss against 4.7 on placebo. REDEFINE 2, the other filing trial, gave minus 13.7 against minus 3.4 percent in 1206 patients with type 2 diabetes.

The REIMAGINE programme published on 7 June 2026. REIMAGINE 2, 2713 patients, holds the largest cagrilintide monotherapy arm in type 2 diabetes, 152 people. Its primary comparison against semaglutide 2.4 mg on HbA1c gave minus 1.91 against minus 1.75 percentage points, a difference of minus 0.16 percentage points, confidence interval minus 0.27 to minus 0.05, p equals 0.0035: significant in 1208 patients, clinically marginal, and reported as a win without being shown at that size. REIMAGINE 3 added the combination to basal insulin in 274 patients and reported, verbatim, that no severe hypoglycaemia was reported.

REDEFINE 4, NCT06131437, is the only head-to-head the molecule has been in: 809 people with obesity, 84 weeks, against tirzepatide 15 mg. On 23 February 2026 the sponsor announced 23.0 against 25.5 percent on the efficacy estimand and 20.2 against 23.6 on the treatment regimen estimand, stating verbatim that CagriSema 2.4/2.4 mg did not meet the primary endpoint of showing non-inferiority on weight loss compared to tirzepatide 15 mg at 84 weeks. There is no publication and no disclosed confidence intervals. Failing non-inferiority is not being ineffective, but the claim that this is the most effective obesity treatment available is not supported by the only head-to-head that exists.

The REDEFINE 1 expectation gap, and the arithmetic

Novo Nordisk had guided to roughly 25 percent. REDEFINE 1 read out at 22.7 on the trial product estimand and 20.4 on treatment policy, the share price fell about a fifth in a session and the trial has been called a failure ever since. It met every prespecified endpoint. The sponsor’s own explanation is the strongest: dosing was flexible, and at week 68 only 57.3 percent of combination recipients were still on the highest dose, against 82.5 percent on cagrilintide monotherapy and 70.2 on semaglutide.

The same arithmetic settles the word synergy. On that estimand semaglutide gave 13.8 percentage points of effect over placebo and cagrilintide gave 9.5, summing to 23.3. The combination gave 20.4. Additive at best, arguably sub-additive, and nothing in it is synergistic.

A standalone drug again, which is new

Until late 2025 cagrilintide appeared alone only as a comparator arm. On 16 September 2025 the sponsor presented the REDEFINE 1 monotherapy data and announced a dedicated phase 3 programme, RENEW. RENEW 1, NCT07220642, randomised 300 adults without diabetes against placebo to a week 64 endpoint, and a companion diabetes trial, NCT07220759, enrolled 330, both from November 2025. The thesis is tolerability, not potency, and the 82.5 against 57.3 percent dose retention is the argument. NCT07607587 states it out loud, testing tolerability in 114 people who stopped GLP-1 receptor agonists because of gastrointestinal side effects.

Safety, with the denominators

Gastrointestinal events are the class effect, mostly mild to moderate and transient. In the dose-finding trial they affected 41 to 63 percent across cagrilintide doses against 32 on placebo. In REDEFINE 1 the combination produced them in 79.6 percent against 39.9, with nausea 55 and vomiting 26.1. In REIMAGINE 2 the monotherapy arm had any adverse event in 82.2 percent, 125 of 152, between placebo at 70.5 and semaglutide at 81.2. Rates for the same regimen vary widely between trials.

Three findings rarely seen elsewhere. A 2026 meta-analysis of three randomised trials put administration-site conditions at a relative risk of 3.27 against semaglutide, 95 percent confidence interval 1.27 to 8.46, and serious adverse events on cagrilintide monotherapy at 1.83, interval 1.03 to 3.24, weak because it barely excludes 1.0 but the only such comparison there is. The cagrilintide plus semaglutide arm of the MASH trial NCT05016882 was not substantially different from placebo on fibrosis while semaglutide alone was nominally significant, a negative result. And the 2026 BMJ network meta-analysis of 262 trials and 99,791 participants placed the combination among the agents with the highest discontinuation for adverse events, with a fatigue relative risk of 3.2, about 92 more cases per 1000 in a year.

Hypoglycaemia is not an intrinsic risk: amylin receptor agonism is not insulinotropic, and pramlintide’s hypoglycaemia came from the mealtime insulin beside it. No amylin receptor agonist has completed a cardiovascular outcomes trial.

Regulatory status

A new drug application for the combination went to the US FDA on 18 December 2025, on REDEFINE 1 and 2. It is not approved. No action date has been made public, no approval in any jurisdiction, and the sponsor says only that the FDA is expected to review it in 2026. No European application has been publicly confirmed, so European status is unknown rather than filed. REDEFINE 4 was not part of the filing basis. Cagrilintide monotherapy is filed nowhere.

What circulates, and why no numbers appear here

Cagrilintide circulates as lyophilised powder under research-use framing, alongside written protocols that read like prescriptions. This site does not reproduce those figures, because the compound is unapproved for every use, because the escalation is where the harm sits, and because nothing in that supply chain establishes that a vial holds what its label claims.

What the record does show is this. One widely copied page carries a dose given three days a week and an eight weeks on, eight weeks off cycle. Every human cagrilintide trial since first-in-human in 2014 has dosed once weekly, which is what a half-life of 159 to 195 hours dictates, and three injections a week of a peptide with a one week half-life would accumulate towards roughly triple the studied exposure. No trial has tested that frequency or any cycling schedule. A second item is a five-step titration ladder attributed to Lau 2021: it is the semaglutide ladder with cagrilintide’s name on it, and its lowest step has never been given as a cagrilintide dose in any published trial.

The rest of the amylin field

Calling cagrilintide the amylin was defensible in 2022. A 2026 review lists cagrilintide, eloralintide, petrelintide, MET-233i, ABBV-295 and AZD6234 in human development, plus zenagamtide, the compound formerly called amycretin, a rename that breaks older cross-links. Eloralintide, a selective agonist, reached roughly 20 percent weight loss at 48 weeks as a single drug in Billings 2025, against cagrilintide’s 11.8 at 68 weeks, and petrelintide had 98 percent of its phase 2 participants reach the maintenance dose.

What the record gets wrong

That the lipid is a C18 fatty acid. It is eicosanedioic acid, a C20 alpha,omega-dicarboxylic acid, on Lys1 through a gamma-glutamate linker. That is not cosmetic: a diacid presents a free terminal carboxylate that changes the albumin-binding geometry. Semaglutide uses a C18 diacid, so the claim reads as semaglutide chemistry stapled onto cagrilintide.

That CagriSema failed REDEFINE 1, when it met every prespecified endpoint and missed a commercial guidance figure, which are different events. That it is the amylin, when six others are in development and two already beat it on the measures above.

The accurate sentence about cagrilintide in September 2026 is a narrow one. It is an investigational once-weekly amylin analogue that produced 11.8 percent weight loss over 68 weeks as a single drug, it is the most clinically advanced amylin programme and neither the most potent nor the best tolerated, it is approved nowhere for anything, and almost every number larger than 12 percent attached to its name belongs to two drugs rather than to this one.

What is not known

What cagrilintide monotherapy does in type 2 diabetes, at arm level. The REIMAGINE 2 arm of 152 people and the four-arm chronic kidney disease trial NCT06131372 both contain monotherapy data, and neither has reached the accessible literature as arm-level numbers.

What the drug does to bone. The calcitonin receptor regulates osteoclasts, and cagrilintide engages it chronically while the patient loses a large amount of weight. NCT07010432 in 144 postmenopausal women reports in 2028. No human bone data exist, in either direction.

Whether the appetite effect is satiation or partly aversive malaise, and whether calcitonin receptor engagement is what drives the aversive part. Cagrilintide produced significantly more conditioned taste avoidance than selective eloralintide in lean rats. No human head-to-head of a selective against a non-selective amylin agonist has been run, and this is the central scientific question of the class.

Cardiovascular outcomes. No amylin receptor agonist has completed an outcomes trial. REDEFINE 3, 7101 patients with established cardiovascular disease, completes in September 2027, so every cardiometabolic claim made today is surrogate-endpoint reasoning.

What happens on stopping. The dose-finding trial had a six week treatment-free follow-up and no published regain data. A weight maintenance trial of 609 people and a long-term trial of 400 report in 2027 and 2028.

Anti-drug antibody rates, which were a prespecified endpoint of the phase 2 trial with antibody-positive follow-up excluded from the in-trial period, and which are not retrievable from the accessible literature. Also unretrieved: the per-arm efficacy figures for the 0.3, 0.6, 1.2 and 2.4 mg arms of that trial, which is why only the range and three anchors appear in this entry.

Whether the energy expenditure component is real in people. About one third of the combination’s weight loss came from blunted metabolic adaptation in rats. The human experiment, NCT07184086, reports in October 2027.

Doses used in published research

Amounts administered under a trial protocol. Not dosing, not a recommendation.
TrialPopulationDose armsDurationWhat it measured
NCT0360048095 exposed adults with BMI 27.0 to 39.9, otherwise healthy, aged 18 to 55Cagrilintide 0.16, 0.30, 0.60, 1.2, 2.4 or 4.5 mg once weekly or matched placebo, 3:1; every arm also received semaglutide 2.4 mg once weekly, co-escalated in 4 week intervals over 16 weeks then 4 weeks at target20 weeks on treatment plus 5 weeks of follow upNumber of treatment emergent adverse events
NCT03856047906 adults with overweight or obesity, without diabetesCagrilintide 0.3, 0.6, 1.2, 2.4 or 4.5 mg once weekly, self injected, against liraglutide 3.0 mg once daily and placebo26 weeks including up to 6 weeks of escalation, then 6 weeks treatment freePercentage change in body weight at week 26
NCT0498257592 adults with type 2 diabetes and BMI 27 or above, on metformin with or without an SGLT2 inhibitorCagrilintide 2.4 mg once weekly, semaglutide 2.4 mg once weekly, or both together, 1:1:132 weeksChange in HbA1c at week 32
REDEFINE 1, NCT055677963,417 adults with BMI 30 or above, or 27 or above with an obesity related complication, without diabetesCagrilintide plus semaglutide 2.4 mg each, semaglutide 2.4 mg, cagrilintide 2.4 mg, or placebo, once weekly, 21:3:3:768 weeksRelative change in body weight and the proportion losing at least 5 percent, co-primary
REIMAGINE 2, NCT060655402,713 adults with type 2 diabetes on metformin with or without an SGLT2 inhibitor, HbA1c 7.0 to 10.5 percent, BMI 25 or aboveCagrilintide 2.4 mg, semaglutide 2.4 mg, semaglutide 1.0 mg, cagrilintide plus semaglutide 2.4 mg each, cagrilintide plus semaglutide 1.0 mg each, or placebo, once weekly68 weeksChange in HbA1c at week 68 against semaglutide 2.4 mg
REIMAGINE 3, NCT06323161274 adults with type 2 diabetes on stable once daily basal insulin, with or without metforminCagrilintide plus semaglutide 2.4 mg each or 1.0 mg each once weekly, or dose matched placebo, 2:2:1:140 weeksChange in HbA1c at week 40
RENEW 1, NCT07220642300 adults with BMI 30 or above, or 27 or above with a weight related comorbidity, without diabetes and never dosed with an amylin based compoundCagrilintide or matched placebo once weekly, 2:1; the dose is not stated in the registry recordTo week 64Relative change in body weight at week 64

No cagrilintide dose has been established as safe or effective for any use, because the compound is not approved for any indication in any country. What follows is a record of what named trials administered under medical supervision, not a regimen.

Lau 2021, NCT03856047, the phase 2 dose-finding trial: cagrilintide 0.3, 0.6, 1.2, 2.4 or 4.5 mg subcutaneously once weekly, self-injected, over 26 weeks including up to six weeks of escalation, against liraglutide 3.0 mg daily and placebo.

Enebo 2021, NCT03600480, the phase 1b combination trial: cagrilintide 0.16, 0.30, 0.60, 1.2, 2.4 or 4.5 mg once weekly, co-escalated with semaglutide 2.4 mg in four week intervals over 16 weeks, then four weeks at target dose. Every arm in that trial, including placebo, also received semaglutide.

Every trial from 2021 onward uses 2.4 mg once weekly, in the REDEFINE, REIMAGINE and RENEW programmes alike, for 40 to 84 weeks. No trial in five years has used 4.5 mg, and the lower 1.0 mg and 1.7 mg strengths appear only in combination arms.

Renal and hepatic impairment pharmacokinetics were studied at single 0.6 mg and 0.9 mg doses in 33 and 32 people, with no clinically relevant exposure differences. Those are single-dose pharmacology studies, not treatment regimens.

Compiled from: Enebo 2021, Lancet, phase 1b combination trial; Lau 2021, Lancet, phase 2 dose-finding monotherapy trial; Garvey 2025, New England Journal of Medicine, REDEFINE 1; NCT07220642, RENEW 1; Sponsor announcements, 2024 to 2026; Buse 2026, Lancet Diabetes and Endocrinology, REIMAGINE 2; REIMAGINE 3, Lancet 2026, basal insulin add-on trial; Nielsen 2026, Clinical Pharmacokinetics

No dose has been established as safe or effective for any indication.

Amounts above record what a named source reported administering in a study. They are not a recommendation, not a protocol, and not instructions.

Converting a vial and a syringe into a draw volume is a separate, mechanical question from what amount to use. The reconstitution calculator does that arithmetic for peptide, HCG, and HGH vials.

Sources

  1. Nielsen MJF, Becker NP, Duus HHH, Kirkeby K, Kupcova V, Lauenborg BW, Low B, Svolgaard O, Witten L. Renal or hepatic impairment does not affect pharmacokinetics, safety, or tolerability of subcutaneous cagrilintide. Clin Pharmacokinet. 2026. Human phase 1, two single dose studies registered as NCT04209049 and NCT05564104. Source for the single 0.6 mg dose given to 33 participants in the renal impairment study and the single 0.9 mg dose given to 32 participants in the hepatic impairment study, each stratified into normal function and mild, moderate and severe impairment. PMID 42228334
  2. Lau DCW, Erichsen L, Francisco AM, et al. Once-weekly cagrilintide for weight management in people with overweight and obesity: a dose-finding phase 2 trial. Lancet 2021;398(10317):2160-2172. NCT03856047. Human, n=906, 26 weeks. Establishes 6.0 to 10.8 percent weight loss across 0.3 to 4.5 mg against 3.0 percent placebo, the six week escalation period, and gastrointestinal events in 41 to 63 percent. PMID 34798060
  3. Enebo LB, Berthelsen KK, Kankam M, et al. Concomitant administration of multiple doses of cagrilintide with semaglutide 2.4 mg: a randomised, controlled, phase 1b trial. Lancet 2021;397(10286):1736-1748. NCT03600480. Human, n=95 exposed, 20 weeks. The source of the human half-life of 159 to 195 hours, of dose-proportional exposure and of the exploratory combination weight-loss figures. PMID 33894838
  4. Frias JP, Deenadayalan S, Erichsen L, et al. Efficacy and safety of co-administered once-weekly cagrilintide 2.4 mg with once-weekly semaglutide 2.4 mg in type 2 diabetes: phase 2 trial. Lancet 2023;402(10403):720-730. NCT04982575. Human, n=92, 32 weeks. Cagrilintide alone lowered HbA1c 0.9 points against 1.8 for semaglutide, and the combination was not superior to semaglutide on HbA1c (p=0.075). PMID 37364590
  5. Garvey WT, Bluher M, Osorto Contreras CK, et al. Coadministered cagrilintide and semaglutide in adults with overweight or obesity. N Engl J Med 2025;393(7):635-647. NCT05567796. Human, n=3417, 68 weeks. Minus 20.4 against minus 3.0 percent placebo on the treatment policy estimand; contains the cagrilintide 2.4 mg monotherapy arm of 302 people. PMID 40544433
  6. Davies MJ, Bajaj HS, Broholm C, et al. Cagrilintide-semaglutide in adults with overweight or obesity and type 2 diabetes. N Engl J Med 2025;393(7):648-659. NCT05394519. Human, n=1206, 68 weeks. Minus 13.7 against minus 3.4 percent placebo. No active comparator and no monotherapy arm. PMID 40544432
  7. Buse JB, Bajaj HS, Dalskov SM, et al. Cagrilintide-semaglutide versus semaglutide or cagrilintide in people with type 2 diabetes (REIMAGINE 2). Lancet Diabetes Endocrinol 2026;14(8):662-677. NCT06065540. Human, n=2713, 68 weeks. HbA1c difference against semaglutide 2.4 mg of minus 0.16 percentage points (95% CI minus 0.27 to minus 0.05, p=0.0035); holds the largest cagrilintide monotherapy arm in diabetes, n=152. PMID 42251859
  8. Cagrilintide-semaglutide as an add-on to basal insulin in adults with type 2 diabetes (REIMAGINE 3): phase 3. Lancet 2026. NCT06323161. Human, n=274, 40 weeks. HbA1c minus 2.33 and minus 2.10 against minus 0.66 percentage points placebo, and the statement that no severe hypoglycaemia was reported. PMID 42251856
  9. Loomba R, George J, Castera L, et al. Zalfermin co-administered with semaglutide in participants with fibrosis and cirrhosis due to MASH: phase 2. Lancet Gastroenterol Hepatol 2026;11(9):797-811. NCT05016882. Human. The exploratory cagrilintide 2.4 mg plus semaglutide 2.4 mg arm of 99 people was not substantially different from placebo on fibrosis improvement, while semaglutide alone was nominally significant. PMID 42456707
  10. Fletcher MM, Keov P, Truong TT, et al. AM833 is a novel agonist of calcitonin family G protein-coupled receptors. J Pharmacol Exp Ther 2021;377(3):417-440. Preclinical. The definitive receptor pharmacology across 25 endpoints, establishing cagrilintide as a non-selective amylin and calcitonin receptor agonist and that calcitonin receptor selective activation alone is not efficacious. PMID 33727283
  11. Kruse T, Hansen JL, Dahl K, et al. Development of cagrilintide, a long-acting amylin analogue. J Med Chem 2021;64(15):11183-11194. Preclinical. The primary design account: the amyloid obstacle, the anti-aggregation substitutions and the selection of cagrilintide for clinical development. PMID 34288673
  12. Structural and mechanistic insights into dual activation of cagrilintide in amylin and calcitonin receptors. Acta Pharmacol Sin 2025;47(1):162-172. Preclinical. Independently confirms residues Glu14, Arg17, Phe23 and Pro37 and explains the bypass binding mode that permits non-selective activation. PMID 40847076
  13. A cross-species atlas of the dorsal vagal complex reveals neural mediators of the effects of cagrilintide on energy balance. Nat Metab 2026;8(8). Preclinical, rat, mouse and macaque. Nucleus of the solitary tract Calcr and Prlh neurons mediate the durable effect, and knocking down dorsal vagal complex Prlh abrogates cagrilintide but not semaglutide in rats. PMID 42260119
  14. Efficacy and safety of cagrilintide and CagriSema versus semaglutide as anti-obesity medications: systematic review, meta-analysis and meta-regression. Diabetes Obes Metab 2026;28(6):4828-4836. Human, 3 randomised trials, n=3545. Administration-site conditions relative risk 3.27 (95% CI 1.27 to 8.46) and cagrilintide monotherapy serious adverse events relative risk 1.83 (1.03 to 3.24) against semaglutide. PMID 41834765
  15. Comparative effects of drugs for adults with overweight or obesity: systematic review and network meta-analysis. BMJ 2026. Human, 262 trials, n=99,791. Places CagriSema among the agents with the highest discontinuation for adverse events and reports a fatigue relative risk of 3.2, about 92 more events per 1000 in a year. PMID 42419792
  16. Alhazmi A, et al. Amylin analogs: the next major class of weight loss therapy. Diabetes Obes Metab 2026, current to 30 April 2026. Narrative review. The competitive inventory: cagrilintide, eloralintide, petrelintide, MET-233i, ABBV-295 and AZD6234, plus combination approaches including CagriSema and zenagamtide. PMID 42452898
  17. Billings LK, Hsia S, Bays H, et al. Eloralintide, a selective amylin receptor agonist: a 48-week phase 2 trial. Lancet 2025;406(10520):2631-2643. NCT06230523. Human, n=263. Weight change of minus 9 to minus 20 percent across 1 to 9 mg against minus 0.4 percent placebo, with nausea reaching 64 percent at 6 mg and fatigue 46 percent at 6 to 9 mg. PMID 41207310
  18. Novo Nordisk. Phase 3 trial of cagrilintide monotherapy against placebo in adults with obesity or overweight without diabetes, n=300, randomised 2 to 1, primary endpoint relative weight change at week 64. Started November 2025, no results posted. Excludes anyone previously dosed with an amylin-based compound. NCT07220642
  19. Novo Nordisk company announcements of 20 December 2024 (REDEFINE 1 four-arm breakdown on both estimands and dose retention of 57.3, 82.5 and 70.2 percent), 16 September 2025 (cagrilintide monotherapy data and the RENEW programme), 18 December 2025 (CagriSema new drug application submitted on REDEFINE 1 and 2) and 23 February 2026 (REDEFINE 4 topline, non-inferiority against tirzepatide 15 mg not met), together with the Roche and Zealand Pharma announcement of 5 March 2026 on petrelintide phase 2. Human trials reported by sponsors without peer-reviewed publication. Company announcements, 20 December 2024 to 23 February 2026